Rabbit Polyclonal NKX2-2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | NKX2-2 antibody was raised against a 19 amino acid synthetic peptide near the center of human NKX2-2. |
Rabbit Polyclonal NKX2-2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | NKX2-2 antibody was raised against a 19 amino acid synthetic peptide near the center of human NKX2-2. |
Rabbit Polyclonal Anti-NKX2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NKX2-2 antibody: synthetic peptide directed towards the N terminal of human NKX2-2. Synthetic peptide located within the following region: MSLTNTKTGFSVKDILDLPDTNDEEGSVAEGPEEENEGPEPAKRAGPLGQ |
Rabbit Polyclonal Anti-NKX2
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-NKX2-2 antibody is: synthetic peptide directed towards the N-terminal region of Human NKX2-2. Synthetic peptide located within the following region: GLAAGAPPQDSSSKSPEPSADESPDNDKETPGGGGDAGKKRKRRVLFSKA |
Rabbit Polyclonal Anti-NKX2-2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-NKX2-2 Antibody: synthetic peptide directed towards the N terminal of human NKX2-2. Synthetic peptide located within the following region: MSLTNTKTGFSVKDILDLPDTNDEEGSVAEGPEEENEGPEPAKRAGPLGQ |
NKX2-2 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human NKX2-2 (NP_002500.1). |