Rabbit polyclonal Anti-PIP4K2A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PIP4K2A antibody: synthetic peptide directed towards the N terminal of human PIP4K2A. Synthetic peptide located within the following region: IDDQDFQNSLTRSAPLPNDSQARSGARFHTSYDKRYIIKTITSEDVAEMH |
Rabbit polyclonal Anti-PIP4K2A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PIP4K2A antibody: synthetic peptide directed towards the middle region of human PIP4K2A. Synthetic peptide located within the following region: EQEEVECEENDGEEEGESDGTHPVGTPPDSPGNTLNSSPPLAPGEFDPNI |
PIP4K2A Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 120-350 of human PIP4K2A (NP_005019.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
