PIP5K2 alpha (PIP4K2A) Rabbit Polyclonal Antibody

CAT#: TA342234

Rabbit polyclonal Anti-PIP4K2A Antibody

Product Images

WB Suggested Anti-PIP4K2A Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PIP4K2A antibody: synthetic peptide directed towards the N terminal of human PIP4K2A. Synthetic peptide located within the following region: IDDQDFQNSLTRSAPLPNDSQARSGARFHTSYDKRYIIKTITSEDVAEMH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 46 kDa
• Gene Name: phosphatidylinositol-5-phosphate 4-kinase type 2 alpha
• Database Link:
  NP_005019
  Entrez Gene 5305 Human
  UniProt ID P48426
• Background: Phosphatidylinositol-5,4-bisphosphate,The precursor to second messengers ofThe phosphoinositide signal transduction pathways, is thought to be involved inThe regulation of secretion, cell proliferation, differentiation, and motility.The protein encoded byThis gene is one of a family of enzymes capable of catalyzingThe phosphorylation of phosphatidylinositol-5-phosphate onThe fourth hydroxyl ofThe myo-inositol ring to form phosphatidylinositol-5,4-bisphosphate.The amino acid sequence ofThis enzyme does not show homology to other kinases, butThe recombinant protein does exhibit kinase activity.This gene is a member ofThe phosphatidylinositol-5-phosphate 4-kinase family. [provided by RefSeq, Jul 2008]
• Synonyms: PI5P4KA; PIP5K2A; PIP5KII-alpha; PIP5KIIA; PIPK
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Inositol phosphate metabolism, Phosphatidylinositol signaling system, Regulation of actin cytoskeleton