Rabbit polyclonal Anti-RBBP7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RBBP7 antibody: synthetic peptide directed towards the N terminal of human RBBP7. Synthetic peptide located within the following region: MTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVH |
Rabbit polyclonal Anti-RBBP7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RBBP7 antibody: synthetic peptide directed towards the middle region of human RBBP7. Synthetic peptide located within the following region: HWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGH |
RBBP7 Rabbit polyclonal Antibody
| Applications | ChIP, IF, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-230 of human RBBP7 (NP_002884.1). |
| Modifications | Unmodified |
RBBP7 Rabbit polyclonal Antibody
| Applications | ChIP, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-230 of human RBBP7 (NP_002884.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China