Antibodies

Jump to Filters
View as table Download
Gtf2h3 Rabbit Polyclonal Antibody
TA329633

USD 375.00

5 Days

Rabbit polyclonal anti-Gtf2h3 antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Gtf2h3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: YPGKNGGLGDFFGDPGNALPDCNPSGSKDGKYELLTVANEVIAEEIKDLM
GTF2H3 Rabbit Polyclonal Antibody
TA376856

USD 220.00

3 Weeks

GTF2H3 Rabbit polyclonal Antibody

Applications IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-308 of human GTF2H3 (NP_001507.2).
Modifications Unmodified