Rabbit Polyclonal Anti-SREBF2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SREBF2 antibody: synthetic peptide directed towards the middle region of human SREBF2. Synthetic peptide located within the following region: PASDSGSQAGFSPYSIDSEPGSPLLDDAKVKDEPDSPPVALGMVDRSRIL |
Anti-SREBF2 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 407-421 amino acids of human sterol regulatory element binding transcription factor 2 |
SREBP2 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human SREBF2 (NP_004590.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
