SREBP2 (SREBF2) Rabbit Polyclonal Antibody

CAT#: TA330405

Rabbit Polyclonal Anti-SREBF2 Antibody

Product Images

WB Suggested Anti-SREBF2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Raji cell lysate SREBF2 is strongly supported by BioGPS gene expression data to be expressed in Human Raji cells

• 

  WB Suggested Anti-SREBF2 Antibody ; Positive Control: Lane 1: 50ug mouse glomerular endothelial lysate; Primary Antibody Dilution : 1:1000; Secondary Antibody : Anti-rabbit-HRP; Secondry Antibody Dilution : 1:5000; Submitted by: Xiaoxin Wang, UC Denver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SREBF2 antibody: synthetic peptide directed towards the middle region of human SREBF2. Synthetic peptide located within the following region: PASDSGSQAGFSPYSIDSEPGSPLLDDAKVKDEPDSPPVALGMVDRSRIL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 124 kDa
• Gene Name: sterol regulatory element binding transcription factor 2
• Database Link:
  NP_004590
  Entrez Gene 20788 MouseEntrez Gene 6721 Human
  UniProt ID Q12772
• Background: SREBF2 is a ubiquitously expressed transcription factor that controls cholesterol homeostasis by stimulating transcription of sterol-regulated genes. This gene encodes a ubiquitously expressed transcription factor that controls cholesterol homeostasis by stimulating transcription of sterol-regulated genes. The encoded protein contains a basic helix-loop-helix-leucine zipper (bHLH-Zip) domain. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: bHLHd2; SREBP-2; SREBP2
• Note: Immunogen sequence homology: Bovine: 100%; Chicken: 100%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Rat: 100%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors