Rabbit Polyclonal Anti-Vps45 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Vps45 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VEYGGKRVRGSDLFSPKDAVAITKQFLKGLKGVENVYTQHQPFLHETLDH |
Rabbit Polyclonal Anti-Vps45 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Vps45 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Vps45. Synthetic peptide located within the following region: PFLHETLDHLIKGRLKENLYPYLGPSTLRDRPQDIIVFIIGGATYEEALT |
Germany
Japan
United Kingdom
China
