Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-RAB22A Antibody - middle region
| Applications | IHC, WB |
| Reactivities | Human, Murine |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAB22A antibody: synthetic peptide directed towards the middle region of human RAB22A. Synthetic peptide located within the following region: IFVETSAKNAININELFIEISRRIPSTDANLPSGGKGFKLRRQPSEPKRS |
Rabbit Polyclonal Anti-RAB14 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Murin |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAB14 antibody: synthetic peptide directed towards the C terminal of human RAB14. Synthetic peptide located within the following region: FLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCG |
Rabbit anti-ACAT2 polyclonal antibody
| Applications | WB |
| Reactivities | Human, Murine, Rat, Porcine, Ovine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from Human ACAT 2 |
Rabbit anti-LPAR1 polyclonal antibody
| Applications | WB |
| Reactivities | Human, Bovine, Murine, Rat, Ovine |
| Conjugation | Unconjugated |
| Immunogen | Human LPA 1 amino acids 342-359 |
Anti-Murine IL-4 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Murine |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Murine IL-4 |
Biotinylated Anti-Murine IL-17A Rabbit Polyclonal Antibody
| Applications | ELISA |
| Reactivities | Murine |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Murine IL-17 (IL-17A) |
Rabbit anti-ACAT1 polyclonal antibody
| Applications | WB |
| Reactivities | Human, Porcine, Rat, Murine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from Human ACAT1. |
Active filters
Reactivities
- Murine
Antibody Hosts
- Rabbit
Filter by
Category
Target Symbol
- CCL11 (2)
- CCL12 (2)
- CCL2 (2)
- CCL22 (2)
- CCL3 (2)
- CCL4 (2)
- CCL5 (2)
- CCL9 (2)
- CSF2 (2)
- CSF3 (2)
- CXCL1 (2)
- CXCL10 (2)
- CXCL2 (2)
- FGF9 (2)
- IFNG (2)
- IL10 (2)
- IL13 (2)
- IL15 (2)
- IL17A (2)
- IL1A (2)
- IL1B (2)
- IL2 (2)
- IL21 (2)
- IL22 (2)
- IL3 (2)
- IL4 (2)
- IL5 (2)
- IL6 (2)
- IL7 (2)
- IL9 (2)
- KITL (2)
- LEP (2)
- RETNLA (2)
- RETNLB (2)
- TNFSF11 (2)
- VEGFA (2)
- ACAT1 (1)
- ACAT2 (1)
- IGF1 (1)
- LPAR1 (1)
- RAB14 (1)
- RAB22A (1)
Applications
Isotypes
Clonalities
Conjugates
Pathways
- Butanoate metabolism (2)
- Fatty acid metabolism (2)
- Lysine degradation (2)
- Metabolic pathways (2)
- Propanoate metabolism (2)
- Pyruvate metabolism (2)
- Synthesis and degradation of ketone bodies (2)
- Terpenoid backbone biosynthesis (2)
- Tryptophan metabolism (2)
- Valine (2)
- leucine and isoleucine degradation (2)
- Endocytosis (1)
- Gap junction (1)
- Neuroactive ligand-receptor interaction (1)