Antibodies

Jump to Filters
View as table Download
Galnt13 Rabbit Polyclonal Antibody
TA342073

USD 375.00

5 Days

Rabbit Polyclonal Anti-Galnt13 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Galnt13 antibody is: synthetic peptide directed towards the C-terminal region of Rat Galnt13. Synthetic peptide located within the following region: EFKDFFYIISPGVVKVDYGDVSVRKTLRENLKCKPFSWYLENIYPDSQIP