Galnt13 Rabbit Polyclonal Antibody

CAT#: TA342073

Rabbit Polyclonal Anti-Galnt13 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "Galnt13"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Rat
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-Galnt13 antibody is: synthetic peptide directed towards the C-terminal region of Rat Galnt13. Synthetic peptide located within the following region: EFKDFFYIISPGVVKVDYGDVSVRKTLRENLKCKPFSWYLENIYPDSQIP
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 61 kDa
Gene Name polypeptide N-acetylgalactosaminyltransferase 13
Background Human homolog is a member of a family of proteins which catalyzeThe transfer of N-acetyl-alpha-d-galactosamine to polypeptides such as mucin which initiates O-Linked glycosylation.
Synonyms FLJ16031; FLJ41157; GalNAc-T13; H_NH0187G20.1; KIAA1918; MGC119459; MGC119461; WUGSC:H_NH0187G20.1
Note Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Horse: 93%; Zebrafish: 79%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.