Antibodies

Jump to Filters
View as table Download
Calcipressin 1 (RCAN1) Rabbit Polyclonal Antibody
TA332613

USD 275.00

3 Weeks

Rabbit anti-RCAN1 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human RCAN1
Calcipressin 1 (RCAN1) Rabbit Polyclonal Antibody
TA309834

USD 424.00

5 Days

Rabbit Polyclonal RCAN1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide made to an internal portion of the human protein (within residues 210-252). [Swiss-Prot# P53805]
Calcipressin 1 (RCAN1) Rabbit Polyclonal Antibody
TA312514

USD 345.00

4 Weeks

Rabbit polyclonal anti-RCAN1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human RCAN1.
Rcan1 Rabbit Polyclonal Antibody
TA329361

USD 375.00

5 Days

Rabbit Polyclonal anti-Rcan1 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Rcan1 antibody is: synthetic peptide directed towards the N-terminal region of Rat Rcan1. Synthetic peptide located within the following region: HLDPRVFVDGLCRAKFESLFRTYDKDITFQYFKSFKRVRINFSNPLSAAD