Antibodies

Jump to Filters
View as table Download
EFEMP2 Rabbit Monoclonal Antibody [Clone ID: EPR684(2)]
TA310442

USD 432.00

In Stock

Rabbit Monoclonal antibody against Fibulin-4 (EFEMP2)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
EFEMP2 Rabbit Polyclonal Antibody
TA315408

USD 345.00

4 Weeks

Rabbit polyclonal anti-EFEMP2 antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human EFEMP2.
EFEMP2 Rabbit Polyclonal Antibody
TA347915

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-EFEMP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EFEMP2 Antibody: A synthesized peptide derived from human EFEMP2
EFEMP2 (C-term) Rabbit Polyclonal Antibody
AP51375PU-N

USD 450.00

2 Weeks

EFEMP2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human, Mouse
Immunogen Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 393-422aa) of human Fibulin-4
EFEMP2 Rabbit Polyclonal Antibody
TA333774

USD 375.00

5 Days

Rabbit Polyclonal Anti-EFEMP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-EFEMP2 Antibody: synthetic peptide directed towards the middle region of human EFEMP2. Synthetic peptide located within the following region: VSAMLVLARPVTGPREYVLDLEMVTMNSLMSYRASSVLRLTVFVGAYTF
EFEMP2 Rabbit Polyclonal Antibody
TA375732

USD 220.00

3 Weeks

EFEMP2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 26-250 of human EFEMP2 (NP_058634.4).
Modifications Unmodified