Rabbit Polyclonal Anti-GSG1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GSG1 Antibody: synthetic peptide directed towards the C terminal of human GSG1. Synthetic peptide located within the following region: VLEFKCKHSKSFKENPNCLPHHHQCFPRRLSSAAPTVGPLTSYHQYHNQP |
Rabbit Polyclonal Anti-GSG1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GSG1 Antibody: synthetic peptide directed towards the C terminal of human GSG1. Synthetic peptide located within the following region: VGPLTSYHQYHNQPIHSVSEGVDFYSELRNKGFQRGASQELKEAVRSSVE |
Rabbit Polyclonal Anti-GSG1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GSG1 Antibody: synthetic peptide directed towards the N terminal of human GSG1. Synthetic peptide located within the following region: NYWFVGTQKVPKPLCEKGLAAKCFDMPVSLDGDTNTSTQEVVQYNWETGD |
Germany
Japan
United Kingdom
China