Germany
Japan
United Kingdom
China
GSG1 Rabbit Polyclonal Antibody
Product Images
Other products for "GSG1"
Specifications
| Product Data | |
| Applications | WB |
| Recommended Dilution | WB |
| Reactivities | Human |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-GSG1 Antibody: synthetic peptide directed towards the N terminal of human GSG1. Synthetic peptide located within the following region: NYWFVGTQKVPKPLCEKGLAAKCFDMPVSLDGDTNTSTQEVVQYNWETGD |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 41 kDa |
| Gene Name | germ cell associated 1 |
| Database Link | |
| Background | GSG1 belongs to the GSG1 family. GSG1 may cause the redistribution of PAPOLB from the cytosol to the endoplasmic reticulum. |
| Synonyms | MGC3146; MGC111023 |
| Note | Immunogen Sequence Homology: Human: 100%; Mouse: 80% |
| Reference Data | |
| Protein Families | Transmembrane |
Documents
| Product Manuals |
| FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.