Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal antibody to Interleukin-24 (interleukin 24)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 142 and 206 of IL24 (Uniprot ID#Q13007) |
Rabbit Polyclonal Interleukin-24 Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody was made against a protein fragment from the C Terminus Region |
Rabbit Polyclonal Anti-IL24 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IL24 antibody is: synthetic peptide directed towards the C-terminal region of IL24. Synthetic peptide located within the following region: STLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALT |
IL24 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human IL24 |
IL24 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 52-140 of human IL24 (NP_001172085.1). |
| Modifications | Unmodified |
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- IL24
Antibody Hosts
- Rabbit