Rabbit Polyclonal LYVE-1 Antibody
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a C-terminal portion of the mouse LYVE1 protein sequence (between residues 250-318). [UniProt# Q8BHC0] |
Rabbit Polyclonal Anti-LYVE1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LYVE1 Antibody: Peptide sequence around aa.271~275 (K-N-Q-Q-K) derived from Human Lymphatic vessel endothelial hyaluronic acid receptor 1. |
LYVE1 (271-275) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Peptide sequence around aa.271~275 derived from Human Lymphatic vessel endothelial hyaluronic acid receptor 1 |
LYVE1 (271-275) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Peptide sequence around aa.271~275 derived from Human Lymphatic vessel endothelial hyaluronic acid receptor 1 |
Rabbit Polyclonal Anti-LYVE1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LYVE1 antibody: synthetic peptide directed towards the N terminal of human LYVE1. Synthetic peptide located within the following region: ARCFSLVLLLTSIWTTRLLVQGSLRAEELSIQVSCRIMGITLVSKKANQQ |
Anti-LYVE1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 20-238 amino acids of human lymphatic vessel endothelial hyaluronan receptor 1 |
Anti-LYVE1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 20-238 amino acids of human lymphatic vessel endothelial hyaluronan receptor 1 |
LYVE1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 20-238 of human LYVE1 (NP_006682.2). |
| Modifications | Unmodified |
LYVE1 Rabbit monoclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
