LYVE1 Rabbit Polyclonal Antibody

CAT#: TA341855

Rabbit Polyclonal Anti-LYVE1 Antibody

Product Images

WB Suggested Anti-LYVE1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: MCF7 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LYVE1 antibody: synthetic peptide directed towards the N terminal of human LYVE1. Synthetic peptide located within the following region: ARCFSLVLLLTSIWTTRLLVQGSLRAEELSIQVSCRIMGITLVSKKANQQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: lymphatic vessel endothelial hyaluronan receptor 1
• Database Link:
  NP_006682
  Entrez Gene 10894 Human
  UniProt ID Q9Y5Y7
• Background: This gene encodes a type I integral membrane glycoprotein.The encoded protein acts as a receptor and binds to both soluble and immobilized hyaluronan.This protein may function in lymphatic hyaluronan transport and have a role in tumor metastasis. [provided by RefSeq, Jul 2008]
• Synonyms: CRSBP-1; HAR; LYVE-1; XLKD1
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 93%; Pig: 86%; Horse: 86%; Dog: 79%; Guinea pig: 79%; Rabbit: 77%

Reference Data

• Protein Families: Druggable Genome, Transmembrane