Rabbit anti-NDRG2 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human NDRG2 |
Rabbit anti-NDRG2 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human NDRG2 |
Rabbit Polyclonal Anti-NDRG2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NDRG2 antibody: synthetic peptide directed towards the C terminal of human NDRG2. Synthetic peptide located within the following region: GYMASSCMTRLSRSRTASLTSAASVDGNRSRSRTLSQSSESGTLSSGPPG |
Rabbit Polyclonal Anti-Ndrg2 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Ndrg2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TEEKPLLPGQTPETAKEAELAARILLDQGQTHSVETPYGSVTFTVYGTPK |
Anti-NDRG2 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 25-39 amino acids of Human NDRG family member 2 |
Anti-NDRG2 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 25-39 amino acids of Human NDRG family member 2 |