Antibodies

View as table Download

Rabbit polyclonal anti-PPIF antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PPIF.

Cyclophilin F (PPIF) (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 102-131 amino acids from the Central region of Human Cyclophilin F.

Rabbit Polyclonal Anti-PPIF Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPIF antibody: synthetic peptide directed towards the middle region of human PPIF. Synthetic peptide located within the following region: GSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLS

Rabbit Polyclonal Anti-PPIF Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PPIF

PPIF rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PPIF

PPIF Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 30-207 of human PPIF (NP_005720.1).
Modifications Unmodified

Cyclophilin F Rabbit polyclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human Cyclophilin F