Antibodies

View as table Download

Rabbit anti-SIRT7 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SIRT7

Rabbit Polyclonal SIRT7 Antibody

Applications IP, WB
Reactivities Bovine, Human, Mouse, Rat
Immunogen Synthetic peptide made to an internal portion of the human protein (within residues 200-300). [Swiss-Prot# Q9NRC8]

Rabbit Polyclonal SIRT7 Antibody

Applications IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide made to an internal portion of the human protein (within residues 100-200). [Swiss-Prot# Q9NRC8]

Rabbit Polyclonal Anti-SIRT7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SIRT7 antibody: synthetic peptide directed towards the middle region of human SIRT7. Synthetic peptide located within the following region: GEEGSHSRKSLCRSREEAPPGDRGAPLSSAPILGGWFGRGCTKRTKRKKV

Rabbit Polyclonal Anti-SIRT7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SIRT7 antibody: synthetic peptide directed towards the C terminal of human SIRT7. Synthetic peptide located within the following region: DVMRLLMAELGLEIPAYSRWQDPIFSLATPLRAGEEGSHSRKSLCRSREE

Rabbit Polyclonal SIRT7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A mixture of synthetic peptides corresponding to amino acids 35-51 and 361-377 of human SIRT7 was used as immunogen.

Anti-SIRT7 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 90-331 amino acids of human sirtuin 7

SIRT7 Antibody - middlel region

Applications WB
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse SIRT7