Antibodies

Jump to Filters
View as table Download
AMACR Rabbit Polyclonal Antibody
TA349234

USD 380.00

In Stock

Rabbit Polyclonal Anti-AMACR Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human AMACR
AMACR (C-term) Rabbit Polyclonal Antibody
AP50158PU-N

USD 450.00

2 Weeks

AMACR (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IF, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 330-359 amino acids from the C-terminal region of human AMACR
AMACR Rabbit Polyclonal Antibody
TA343068

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-AMACR Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AMACR antibody: synthetic peptide directed towards the C terminal of human AMACR. Synthetic peptide located within the following region: IFDGTDACVTPVLTFEEVVHHDHNKERGSFITSEEQDVSPRPAPLLLNTP
AMACR Rabbit Polyclonal Antibody
TA326939

USD 345.00

3 Weeks

Rabbit anti-AMACR Polyclonal Antibody

Applications WB
Reactivities Human Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human AMACR
AMACR Rabbit Polyclonal Antibody
TA354914

USD 355.00

5 Days

Rabbit anti AMACR Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated
AMACR Rabbit Polyclonal Antibody
TA368747

USD 380.00

4 Weeks

AMACR rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human AMACR