Antibodies

Jump to Filters
View as table Download
Apolipoprotein L 2 (APOL2) Rabbit Polyclonal Antibody
TA371210

USD 380.00

4 Weeks

APOL2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human APOL2
Apolipoprotein L 2 (APOL2) Rabbit Polyclonal Antibody
TA312421

USD 345.00

In Stock

Rabbit polyclonal anti-APOL2 antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human APOL2.
Apolipoprotein L 2 (APOL2) Rabbit Polyclonal Antibody
TA339568

USD 375.00

5 Days

Rabbit Polyclonal Anti-APOL2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-APOL2 antibody: synthetic peptide directed towards the middle region of human APOL2. Synthetic peptide located within the following region: DVVSLAYESKHLLEGAKSESAEELKKRAQELEGKLNFLTKIHEMLQPGQD
Apolipoprotein L 2 (APOL2) Rabbit Polyclonal Antibody
TA350861

USD 345.00

In Stock

Rabbit Polyclonal Anti-APOL2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human APOL2
Apolipoprotein L 2 (APOL2) Rabbit Polyclonal Antibody
TA373605

USD 220.00

3 Weeks

APOL2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 170-270 of human APOL2 (NP_663612.2).
Modifications Unmodified