Antibodies

Jump to Filters
View as table Download
ARL17B (Center) Rabbit Polyclonal Antibody
AP50243PU-N

USD 450.00

2 Weeks

ARL17B (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 109-139 amino acids from the Central region of human ARL17P1
ARL17B Rabbit Polyclonal Antibody
TA336004

USD 375.00

5 Days

Rabbit Polyclonal Anti-ARL17 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ARL17 Antibody: synthetic peptide directed towards the middle region of human ARL17. Synthetic peptide located within the following region: KCSHVEFGMWKGGRSHPFLPHSSRCAGSGGQLDSILPHQSPAWGPWGCKD