ARL17B Rabbit Polyclonal Antibody

CAT#: TA336004

Rabbit Polyclonal Anti-ARL17 Antibody

Product Images

WB Suggested Anti-ARL17 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human Placenta

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ARL17 Antibody: synthetic peptide directed towards the middle region of human ARL17. Synthetic peptide located within the following region: KCSHVEFGMWKGGRSHPFLPHSSRCAGSGGQLDSILPHQSPAWGPWGCKD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 19 kDa
• Gene Name: ADP ribosylation factor like GTPase 17B
• Database Link:
  NP_001034172
  Entrez Gene 100506084 Human
  UniProt ID Q8IVW1
• Background: ARL17 is a GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. ARL17 is involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.
• Synonyms: ARL17; ARL17A
• Note: Immunogen Sequence Homology: Human: 100%