Antibodies

View as table Download

Rabbit anti-CAMK4 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CAMK4

Rabbit Polyclonal CaMK4 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human CaMK4

Rabbit Polyclonal CaMK4 (Thr196/200) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human CaMK4 around the phosphorylation site of Threonine 196/200
Modifications Phospho-specific

Rabbit polyclonal CaM Kinase IV antibody

Applications IHC, WB
Reactivities Bovine, Chimpanzee, Human, Mouse, Rat, Dog
Conjugation Unconjugated
Immunogen This antiserum was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 305-323 of Human CaM Kinase IV protein.

Rabbit Polyclonal Anti-CAMK4 Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for anti-CAMK4 antibody: synthetic peptide directed towards the C terminal of mouse CAMK4. Synthetic peptide located within the following region: VKAVVASSRLGSASSSHTSIQENHKASSDPPSTQDAKDSTDLLGKKMQEE

Rabbit Polyclonal Anti-Camk4 Antibody

Applications WB
Reactivities Mouse
Immunogen The immunogen for Anti-Camk4 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Camk4. Synthetic peptide located within the following region: DSTDLLGKKMQEEDQEEDQVEAEASADEMRKLQSEEVEKDAGVKEEETSS

Rabbit anti CaM Kinase IV Polyclonal Antibody

Applications IHC
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide from aa 457-474 of rat CaM Kinase IV.

Rabbit Polyclonal Anti-CAMK4 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CAMK4

CAMK4 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated

CAMK4 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated

CAMK4 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CAMK4

CAMK4 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CAMK4

CAMK4 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CAMK4

CAMK4 Rabbit polyclonal Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 304-473 of human CAMK4 (NP_001735.1).