Antibodies

View as table Download

Rabbit Polyclonal Anti-ELL Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ELL antibody: synthetic peptide directed towards the N terminal of human ELL. Synthetic peptide located within the following region: GLSCGRVSDGSKVSVFHVKLTDSALRAFESYRARQDSVSLRPSIRFQGSQ

Rabbit polyclonal anti-ELL antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ELL.

ELL rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse

Rabbit Polyclonal anti-ELL antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ELL antibody: synthetic peptide directed towards the C terminal of human ELL. Synthetic peptide located within the following region: TQLDAQLRQLSQGSEEYETTRGQILQEYRKIKKTNTNYSQEKHRCEYLHS

ELL (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 523-553aa) of human ELL.

ELL (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 523-553aa) of human ELL.

Rabbit Polyclonal anti-ELL antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ELL antibody: synthetic peptide directed towards the middle region of human ELL. Synthetic peptide located within the following region: TDCAQPSRPHGSPSRSKPKKKSKKHKDKERAAEDKPRAQLPDCAPATHAT

ELL Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 350-450 of human ELL (NP_006523.1).
Modifications Unmodified

ELL Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 350-450 of human ELL (NP_006523.1).
Modifications Unmodified