ELL Rabbit Polyclonal Antibody

CAT#: TA343619

Rabbit Polyclonal Anti-ELL Antibody

Product Images

WB Suggested Anti-ELL Antibody Titration: 7.5 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Transfected 293T

• 

  Human Muscle

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ELL antibody: synthetic peptide directed towards the N terminal of human ELL. Synthetic peptide located within the following region: GLSCGRVSDGSKVSVFHVKLTDSALRAFESYRARQDSVSLRPSIRFQGSQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 68 kDa
• Gene Name: elongation factor for RNA polymerase II
• Database Link:
  NP_006523
  Entrez Gene 8178 Human
  UniProt ID P55199
• Background: ELL was shown to encode a previously uncharacterized elongation factor that can increase the catalytic rate of RNA polymerase II transcription by suppressing transient pausing by polymerase at multiple sites along the DNA. Functionally, ELL resembles Elongin (SIII), a transcription elongation factor regulated by the product of the von Hippel-Lindau (VHL) tumor suppressor gene.
• Synonyms: C19orf17; ELL1; MEN; PPP1R68
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 93%; Pig: 92%; Rat: 92%; Mouse: 92%; Guinea pig: 92%; Dog: 86%

Reference Data

• Protein Families: Transcription Factors