Antibodies

Jump to Filters
View as table Download
IL1F10 Rabbit Polyclonal Antibody
TA326664

USD 430.00

5 Days

Rabbit Polyclonal IL-1F10 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen IL-1F10 antibody was raised against a 17 amino acid peptide near the carboxy terminus of human IL-1F10.
IL1F10 Rabbit Polyclonal Antibody
TA342892

USD 375.00

5 Days

Rabbit Polyclonal Anti-IL1F10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL1F10 antibody: synthetic peptide directed towards the middle region of human IL1F10. Synthetic peptide located within the following region: SRCLACVETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEA
IL1F10 Rabbit Polyclonal Antibody
TA377443

USD 220.00

3 Weeks

IL1F10 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-152 of human IL1F10 (NP_115945.4).
Modifications Unmodified