Rabbit Polyclonal Anti-KLF12 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KLF12 antibody: synthetic peptide directed towards the N terminal of human KLF12. Synthetic peptide located within the following region: NIHMKRKTIKNINTFENRMLMLDGMPAVRVKTELLESEQGSPNVHNYPDM |
Rabbit Polyclonal Anti-KLF12 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-KLF12 Antibody: synthetic peptide directed towards the N terminal of human KLF12. Synthetic peptide located within the following region: MEAVPLLLNNVKGEPPEDSLSVDHFQTQTEPVDLSINKARTSPTAVSSSP |
KLF12 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human KLF12 |
KLF12 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human KLF12. |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
