Rabbit monoclonal antibody against LMO2(clone EP3257)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit monoclonal antibody against LMO2(clone EP3257)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal LMO2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Bovine |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to an N-terminal portion of the human LMO2 protein (within residues 1-100). [Swiss-Prot# P25791] |
Rabbit Polyclonal anti-LMO2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-LMO2 antibody is: synthetic peptide directed towards the N-terminal region of Human LMO2. Synthetic peptide located within the following region: RKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLS |
Rabbit Polyclonal Anti-LMO2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LMO2 antibody: synthetic peptide directed towards the N terminal of human LMO2. Synthetic peptide located within the following region: GGGARAPEGVRAPAAGQPRATKGAPPPPGTPPPSPMSSAIERKSLDPSEE |
Lmo2 Antibody - C-terminal region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
LMO2 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-158 of human LMO2 (NP_001135788.1). |
Modifications | Unmodified |
LMO2 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-158 of human LMO2 (NP_001135788.1). |
Modifications | Unmodified |
LMO2 Rabbit polyclonal Antibody
Applications | FC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human LMO2 |
LMO2 Rabbit monoclonal Antibody
Applications | IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |