Rabbit polyclonal anti-NKX6.3 antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NKX6.3. |
Rabbit polyclonal anti-NKX6.3 antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NKX6.3. |
Rabbit Polyclonal Anti-NKX6-3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NKX6-3 antibody: synthetic peptide directed towards the N terminal of human NKX6-3. Synthetic peptide located within the following region: RLCSGPWGLPELQPAAPSSSAAQLPWGESWGEEADTPACLSASGVWFQNR |
Rabbit Polyclonal Anti-NKX6-3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NKX6-3 antibody: synthetic peptide directed towards the middle region of human NKX6-3. Synthetic peptide located within the following region: EPSSSTPRAPGGAGAGAGGDRAPSENEDDEYNKPLDPDSDDEKIRLLLRK |
Rabbit Polyclonal Anti-NKX6.3 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NKX6.3 Antibody: A synthesized peptide derived from human NKX6.3 |
Rabbit polyclonal NKX6-3 Antibody (Center)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This NKX6-3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 83-109 amino acids from the Central region of human NKX6-3. |
NKX6-3 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human NKX6-3 |