nkx6.3 (NKX6-3) Rabbit Polyclonal Antibody

CAT#: TA345550

Rabbit Polyclonal Anti-NKX6-3 Antibody

Product Images

WB Suggested Anti-NKX6-3 Antibody Titration: 5.0 ug/ml; ELISA Titer: 1: 312500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NKX6-3 antibody: synthetic peptide directed towards the N terminal of human NKX6-3. Synthetic peptide located within the following region: RLCSGPWGLPELQPAAPSSSAAQLPWGESWGEEADTPACLSASGVWFQNR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 14 kDa
• Gene Name: NK6 homeobox 3
• Database Link:
  NP_689781
  Entrez Gene 157848 Human
  UniProt ID A6NJ46
• Background: Nkx6.3 is a new member of the Nkx6 subfamily of homeodomain proteins. Members of the Nkx family of homeodomain proteins are involved in a variety of developmental processes such as cell fate determination in the CNS and in the pancreas. Nkx6.3 is expressed in the developing CNS and gastro-intestinal tract. Nkx6.3 shows a remarkably selective expression in a subpopulation of differentiating V2 neurons at caudal hindbrain levels. In the gut, Nkx6.3 is expressed in duodenal and glandular stomach endoderm and at the end of gestation Nkx6.3 became restricted to the base of the gastric units in the glandular stomach.
• Synonyms: NKX6.3
• Note: Immunogen Sequence Homology: Human: 100%