Rabbit Polyclonal Anti-NSUN2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NSUN2 antibody: synthetic peptide directed towards the C terminal of human NSUN2. Synthetic peptide located within the following region: FINSRIITVSMEDVKILLTQENPFFRKLSSETYSQAKDLAKGSIVLKYEP |
NSUN2 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 426-455 amino acids from the Central region of human NSUN2 |
Rabbit polyclonal anti-NSun2 (Misu) antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | NSun2 (Misu) |
NSUN2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human NSUN2 |
NSUN2 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 508-767 of human NSUN2 (NP_060225.4). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China