Antibodies

View as table Download

Rabbit Polyclonal Anti-Pak4 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Pak4 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: TGFDQHEQKFTGLPRQWQSLIEESARRPKPLIDPACITSIQPGAPKTIVR

Rabbit Polyclonal Anti-PAK4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PAK4 antibody is: synthetic peptide directed towards the middle region of Human PAK4. Synthetic peptide located within the following region: EPQLAPPACTPAAPAVPGPPGPRSPQREPQRVSHEQFRAALQLVVDPGDP

Rabbit Polyclonal PAK4 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen PAK4 antibody was raised against a 13 amino acid peptide from near the center of human PAK4.

Anti-PAK4 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 321-572 amino acids of human p21 protein (Cdc42/Rac)-activated kinase 4

PAK4 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat

Rabbit anti PAK4(pS474) Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide surrounding the epitope RKSLV-with a phosphorylation at Serine 474 of human PAK4. This sequence is also identical within human, rat, mouse, chicken, bovine and dog species.

Rabbit anti PAK4 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide derived from internal sequence of human PAK4. This sequence is also identical within human, rat, mouse, chicken, bovine and dog species.

PAK4 rabbit polyclonal antibody

Applications ELISA, IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human PAK4

PAK4 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 120-280 of human PAK4 (NP_001014831.1).
Modifications Unmodified

Phospho-PAK4/5/6 (Ser474/Ser560/Ser602) Rabbit polyclonal Antibody

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human Phospho-PAK4 + PAK5 + PAK6 (S474 + S560 + S602) (Phosphorylated)