Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-PIEZO2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PIEZO2 antibody is: synthetic peptide directed towards the N-terminal region of Human PIEZO2. Synthetic peptide located within the following region: VFGFWAFGKHSAAADITSSLSEDQVPGPFLVMVLIQFGTMVVDRALYLRK |
Rabbit Polyclonal Anti-PIEZO2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PIEZO2antibody: synthetic peptide directed towards the middle region of human FAM38B. Synthetic peptide located within the following region: AGNSTESSKTPVTIEKIYPYYVKAPSDSNSKPIKQLLSENNFMDITIILS |
FAM38B (PIEZO2) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | conjugated synthetic peptide between 366-396 amino acids of human FAM38B |
Rabbit Polyclonal Anti-PIEZO2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | PIEZO2 antibody was raised against a peptide corresponding to 14 amino acids near the amino terminus of human PIEZO2. |
PIEZO2 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human PIEZO2 |
Active filters
Target Symbol
- PIEZO2
Antibody Hosts
- Rabbit