Rabbit Polyclonal Anti-RAB23 Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Rab23 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DPEQTHSSSNKIGVFNASVRSHLGQNSSSLNGGDVINLRPNKQRTKRTRN |
Rabbit Polyclonal Anti-RAB23 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAB23 antibody: synthetic peptide directed towards the N terminal of human RAB23. Synthetic peptide located within the following region: TKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEEFDAITKAYYRGAQA |
RAB23 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-237 of human RAB23 (NP_057361.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
