RAB23 Rabbit Polyclonal Antibody

CAT#: TA345044

Rabbit Polyclonal Anti-RAB23 Antibody - middle region


USD 475.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Recombinant protein of human RAB23, member RAS oncogene family (RAB23), transcript variant 1
    • 20 ug

USD 823.00


Transient overexpression lysate of RAB23, member RAS oncogene family (RAB23), transcript variant 1
    • 100 ug

USD 396.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Other products for "RAB23"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Rab23 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DPEQTHSSSNKIGVFNASVRSHLGQNSSSLNGGDVINLRPNKQRTKRTRN
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 26 kDa
Gene Name RAB23, member RAS oncogene family
Background The function remains unknown.
Synonyms HSPC137
Note Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 93%; Bovine: 93%; Guinea pig: 93%; Zebrafish: 79%
Reference Data
Protein Families Druggable Genome
Protein Pathways Hedgehog signaling pathway

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.