Rabbit Polyclonal Anti-RPAIN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RPAIN antibody: synthetic peptide directed towards the C terminal of human RPAIN. Synthetic peptide located within the following region: VVCQCGLSIPSHSSELTEQKLRACLEGSINEHSAHCPHTPEFSVTGGTEE |
RPAIN (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 15-44 amino acids from the N-terminal region of human RPAIN |
Rabbit Polyclonal RPA Interacting Protein Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | RPA Interacting Protein antibody was raised against a 17 amino acid peptide from near the carboxy terminus of human RPA Interacting Protein. |
Germany
Japan
United Kingdom
China
