RPAIN Rabbit Polyclonal Antibody

CAT#: TA346262

Rabbit Polyclonal Anti-RPAIN Antibody

Product Images

WB Suggested Anti-RPAIN Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: 293T cell lysateRPAIN is supported by BioGPS gene expression data to be expressed in HEK293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RPAIN antibody: synthetic peptide directed towards the C terminal of human RPAIN. Synthetic peptide located within the following region: VVCQCGLSIPSHSSELTEQKLRACLEGSINEHSAHCPHTPEFSVTGGTEE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 25 kDa
• Gene Name: RPA interacting protein
• Database Link:
  NP_001028174
  Entrez Gene 84268 Human
  UniProt ID Q86UA6
• Background: RPAIN mediates the import of RPA complex into the nucleus, possibly via some interaction with importin beta. Isoform 2 is sumoylated and mediates the localization of RPA complex into the PML body of the nucleus, thereby participating in RPA function in DNA metabolism.
• Synonyms: HRIP; RIP
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 93%; Horse: 93%; Pig: 86%; Guinea pig: 86%; Bovine: 85%; Mouse: 79%