Rabbit Polyclonal Anti-SLC10A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SLC10A1 antibody: synthetic peptide directed towards the middle region of human SLC10A1. Synthetic peptide located within the following region: VFSLAMKGDMNLSIVMTTCSTFCALGMMPLLLYIYSRGIYDGDLKDKVPY |
Anti-SLC10A1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 2-15 amino acids of Human solute carrier family 10 (sodium/bile acid cotransporter family), member 1 |
SLC10A1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 244-349 of mouse SLC10A1 (O08705). |
| Modifications | Unmodified |
SLC10A1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human SLC10A1 (NP_003040.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
