Antibodies

Jump to Filters
View as table Download
Tmco3 (Center) Rabbit Polyclonal Antibody
AP46058PU-N

USD 445.00

2 Weeks

Tmco3 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen Synthetic peptide corresponding to the middle region of mouse Tmco3
TMCO3 Rabbit Polyclonal Antibody
TA342047

USD 375.00

5 Days

Rabbit Polyclonal Anti-TMCO3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TMCO3 antibody: synthetic peptide directed towards the N terminal of human TMCO3. Synthetic peptide located within the following region: KTAIGAVEKDVGLSDEEKLFQVHTFEIFQKELNESENSVFQAVYGLQRAL
Tmco3 Rabbit Polyclonal Antibody
TA356644

USD 360.00

5 Days

Tmco3 Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated