Rabbit Polyclonal Anti-Two Pore Calcium Channel Protein 1 (extracellular)
| Applications | IHC, WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)RNLRQIFQSLPPFMD, corresponding to amino acid residues 221-235 of rat Two Pore Calcium Channel Protein 1. 2nd extracellular loop for Two pore calcium channel protein 1 expressed on the plasma membrane. Luminal for Two pore calcium channel prote |
Rabbit Polyclonal Anti-TPCN1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TPCN1 antibody: synthetic peptide directed towards the N terminal of human TPCN1. Synthetic peptide located within the following region: YQEAAIYLQEGENNDKFFTHPKDAKALAAYLFAHNHLFYLMELATALLLL |
TPCN1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human TPCN1 |
TPCN1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 692-816 of human TPCN1 (NP_060371.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
