TPCN1 Rabbit Polyclonal Antibody

CAT#: TA338582

Rabbit Polyclonal Anti-TPCN1 Antibody

Product Images

WB Suggested Anti-TPCN1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: HT1080 cell lysate

• 

  Host: Rabbit; Target Name: TPCN1; Sample Tissue: HT1080; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TPCN1 antibody: synthetic peptide directed towards the N terminal of human TPCN1. Synthetic peptide located within the following region: YQEAAIYLQEGENNDKFFTHPKDAKALAAYLFAHNHLFYLMELATALLLL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 94 kDa
• Gene Name: two pore segment channel 1
• Database Link:
  NP_060371
  Entrez Gene 53373 Human
  UniProt ID Q9ULQ1
• Background: Voltage-gated Ca(2+) and Na+ channels have 4 homologous domains, each containing 6 transmembrane segments, S1 to S6. TPCN1 is similar to these channels, but it has only 2 domains containing S1 to S6 (Ishibashi et al., 2000 [PubMed 10753632]). [supplied by OMIM, Mar 2008]. Transcript Variant: This variant (2) differs in the 5' UTR, lacks a portion of the 5' coding region, and uses a downstream start codon, compared to variant 1. The encoded isoform (2) has a shorter N-terminus compared to isoform 1. ##Evidence-Data-START## Transcript exon combination :: BC150203.1, AB032995.2 [ECO:0000332] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.
• Synonyms: TPC1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Mouse: 93%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Other, Transmembrane