Rabbit polyclonal Anti-TPTE Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TPTE antibody: synthetic peptide directed towards the middle region of human TPTE. Synthetic peptide located within the following region: YFAQVKHLYNWNLPPRRILFIKHFIIYSIPRYVRDLKIQIEMEKKVVFST |
Rabbit Polyclonal Anti-TPTE Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TPTE antibody: synthetic peptide directed towards the C terminal of human TPTE. Synthetic peptide located within the following region: KILIDVFDGPPLYDDVKVQFFYSNLPTYYDNCSFYFWLHTSFIENNRLYL |
Rabbit Polyclonal anti-PP2447 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PP2447 antibody: synthetic peptide directed towards the N terminal of human PP2447. Synthetic peptide located within the following region: MDGEEQQPPHEANVEPVVPSEASEPVPRVLSGDPQNLSDVDAFNLLLEMK |
Rabbit Polyclonal anti-TRABD antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRABD antibody: synthetic peptide directed towards the middle region of human TRABD. Synthetic peptide located within the following region: LCFLSDPISKDDVERCKQKDLLEQMMAEMIGEFPDLHRTIVSERDVYLTY |
Rabbit Polyclonal Anti-TPTE Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TPTE antibody: synthetic peptide directed towards the middle region of human TPTE. Synthetic peptide located within the following region: IQIEMEKKVVFSTISLGKCSVLDNITTDKILIDVFDGLPLYDDVKVQFFY |
Rabbit Polyclonal Anti-TPTE Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TPTE antibody: synthetic peptide directed towards the C terminal of human TPTE. Synthetic peptide located within the following region: MNESPDPTDLAGVIIELGPNDSPQTSEFKGATEEAPAKESVLARLSKFEV |
TPTE Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human TPTE |
TPTE Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human TPTE |
Germany
Japan
United Kingdom
China
