Rabbit polyclonal anti-ZNF420 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ZNF420. |
Rabbit polyclonal anti-ZNF420 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ZNF420. |
Rabbit Polyclonal Anti-ZNF420 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ZNF420 antibody: synthetic peptide directed towards the N terminal of human ZNF420. Synthetic peptide located within the following region: LENYSNLVSLDLPSRCASKDLSPEKNTYETELSQWEMSDRLENCDLEESN |
Rabbit Polyclonal Anti-ZNF420 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ZNF420 |
ZNF420 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ZNF420 |