Antibodies

View as table Download

Rabbit Polyclonal Anti-TAF4 Antibody

Applications 10k-ChIP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TAF4 Antibody: synthetic peptide directed towards the middle region of human TAF4. Synthetic peptide located within the following region: EQASDVRAQLKFFEQLDQIEKQRKDEQEREILMRAAKSRSRQEDPEQLRL

Purified P53 (TP53) mouse monoclonal antibody, clone UMAB62

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) Purified P53 (TP53) mouse monoclonal antibody, clone UMAB62

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Purified P53 (TP53) mouse monoclonal antibody, clone UMAB62

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

P53 (TP53) mouse monoclonal antibody, clone UMAB206

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) P53 (TP53) mouse monoclonal antibody, clone UMAB206

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

P53 (TP53) mouse monoclonal antibody, clone UMAB206

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated