Mouse Monoclonal GR Antibody
Applications | Assay, ELISA, IHC, IP, WB |
Reactivities | Human |
Mouse Monoclonal GR Antibody
Applications | Assay, ELISA, IHC, IP, WB |
Reactivities | Human |
Mouse Monoclonal ER alpha Antibody
Applications | Assay, IHC, WB |
Reactivities | Human |
Rabbit Polyclonal Anti-Thrb Antibody
Applications | Assay, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Thrb antibody: synthetic peptide directed towards the N terminal of mouse Thrb. Synthetic peptide located within the following region: KSKDSDLDMALSQSSQPAHLPEEKPFPQVQSPPHSQKKGYIPSYLDKDEL |
Mouse Monoclonal ER alpha Antibody
Applications | Assay |
Reactivities | Human |