Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal Anti-PRKCG Antibody
| Applications | Assay, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRKCG antibody: synthetic peptide directed towards the N terminal of human PRKCG. Synthetic peptide located within the following region: FVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL |
Rabbit Polyclonal Anti-CTNNB1 Antibody
| Applications | Assay, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CTNNB1 antibody: synthetic peptide directed towards the middle region of human CTNNB1. Synthetic peptide located within the following region: RTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDP |
Rabbit Polyclonal Anti-CTNNB1 Antibody
| Applications | Assay, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CTNNB1 antibody is: synthetic peptide directed towards the C-terminal region of Human CTNNB1. Synthetic peptide located within the following region: LGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPG |
Active filters
Applications
- Assay
Pathways
- Leukocyte transendothelial migration