Antibodies

Jump to Filters
View as table Download
c-Jun (JUN) Rabbit Polyclonal Antibody
TA330130

USD 375.00

5 Days

Rabbit Polyclonal Anti-JUN Antibody

Applications Assay, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-JUN antibody: synthetic peptide directed towards the N terminal of human JUN. Synthetic peptide located within the following region: TAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKP